Entry 0028Rev 1.0GLP-1 and glucagon dual agonist

Mazdutide

Lipidated 34-residue oxyntomodulin analogue · C210H322N46O67

Reviewed

2 Nov 2026

Scientific editor

[Name, PhD]

References

14 sources

Mazdutide is a 34-residue peptide from Eli Lilly that acts on the GLP-1 and glucagon receptors, built on oxyntomodulin and carrying a C20 fatty chain. Innovent Biologics develops it in China.1,5

In June 2025 China approved it for weight management, the first approval anywhere for a drug of this class, and in September 2025 for type 2 diabetes. At this revision it is not approved in the US, EU or UK.5,6

Residues

34

Avg mass

4563.1 g/mol

GLORY-1, higher dose

−14.0% at 48 wk

Licensed

China only

01

Identity

Value
SequenceHXQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG-NH2; X is Aib1
Fatty chainC20 diacid on Lys20 through γ-glutamic acid and two AEEA linkers1
ReceptorsGLP-1 and glucagon5
DevelopersEli Lilly; Innovent Biologics in China5
CodesLY3305677, IBI362. Sold in China as Xinermei5
CAS2259884-03-01
Mazdutide residue chain: 34 residues, Aib at position 2, and the fatty chain on lysine 20
Fig. 1. The 34-residue chain. X is Aib; the red residue is lysine 20, which carries the C20 diacid side chain.
02

History

  1. Chinese phase 2 in obesity published: 6.7% to 11.3% weight loss at 24 weeks.2

  2. Chinese phase 2 in type 2 diabetes published.3

  3. GLORY-1 phase 3 published in the NEJM.4

  4. China approves it for chronic weight management.5,6

  5. China approves it for type 2 diabetes.6

  6. DREAMS-1 and DREAMS-2 published; GLORY-2 (higher dose) and a US phase 2 by Lilly published. A higher-dose application is under review in China.7,8,9,10,12

03

What the trials measured

TrialPeopleDurationMain resultSource
Phase 2, China248 adults with overweight or obesity24 weeks−6.7% to −11.3% vs +1.0% placebo[2]
GLORY-1610 Chinese adults48 weeks−11.0% and −14.0% by dose vs +0.3% placebo[4]
GLORY-2462 Chinese adults with BMI 30 or more60 weeks−16.7% vs −1.5% placebo[7]
DREAMS-2731 with type 2 diabetes, vs dulaglutide28 weeksGreater HbA1c and weight reduction than dulaglutide[10]
DREAMS-3349 with type 2 diabetes, vs semaglutide32 weeksComposite of HbA1c under 7% and 10% weight loss: 48.0% vs 21.0% (company report)[11]
US phase 2 (Lilly)179 adults without diabetes48 weeks−7.3% to −18.1% at week 32 by dose vs −0.9% placebo[8]

Side effects were mainly diarrhoea, nausea and vomiting, mostly mild to moderate. Almost all of the large trials were in Chinese adults.4,7

04

Regulatory and sport status

As of this revision.

WhereStatus
ChinaApproved for weight management (June 2025) and type 2 diabetes (September 2025).5,6
USNot approved. FDA warning letters in 2026 described mazdutide sold online by peptide vendors as an unapproved new drug.13
EU and UKNot authorised; no application found.
SportNot named on the 2026 WADA list. Because it is approved in China, the class for unapproved substances (S0) may not apply; athletes should check with their anti-doping body.14
05

Open questions

  1. Long-term heart, liver and lean-mass effects of glucagon-receptor activity. No outcomes trial has been published.
  2. How it performs outside Chinese populations. Only one US phase 2 has reported, and no phase 3 outside China is registered.8
  3. How it compares with tirzepatide. A head-to-head trial is running.12
06

Common questions

What class is mazdutide?

A dual agonist at the GLP-1 and glucagon receptors, based on oxyntomodulin.

Where is it approved?

In mainland China, for weight management and type 2 diabetes.

Is it FDA-approved?

No.

Has it been compared with semaglutide?

Yes, in DREAMS-3 in type 2 diabetes, reported by the company; a peer-reviewed paper had not appeared at this revision.

How is it different from survodutide?

Both act on GLP-1 and glucagon receptors. Mazdutide has 34 residues and a C20 fatty chain; survodutide has 29 residues and a C18 chain.

—

See also

Survodutide Entry 0027Retatrutide Entry 0005Semaglutide Entry 0007Metabolic Shelf
07

References

  1. FDA Global Substance Registration System (UNII MB76Z4IBZ5) and KEGG DRUG D12225, checked 3 Nov 2026.
  2. Ji L, et al. A phase 2 randomised controlled trial of mazdutide in Chinese overweight adults or adults with obesity. Nat Commun. 2023;14(1):8289. PMID 38092790
  3. Zhang B, et al. Efficacy and safety of mazdutide in Chinese patients with type 2 diabetes. Diabetes Care. 2024;47(1):160–168. PMID 37943529
  4. Ji L, et al. Once-weekly mazdutide in Chinese adults with obesity or overweight. N Engl J Med. 2025;392(22):2215–2225. PMID 40421736
  5. Shirley M. Mazdutide: first approval. Drugs. 2025;85(12):1621–1627. PMID 41028652
  6. Innovent Biologics. Announcements of NMPA approval for chronic weight management, 27 June 2025, and for glycaemic control in type 2 diabetes, 19 September 2025. hkexnews.hk; prnewswire.com
  7. Gao L, et al. Treatment with 9-mg mazdutide for weight reduction in Chinese adults with obesity: the GLORY-2 randomized clinical trial. JAMA. 2026;336(5):377–388. PMID 42251595
  8. Hsia SH, et al. Efficacy and safety of mazdutide in adults with obesity or overweight: a US-based phase 2 trial. Lancet Diabetes Endocrinol. 2026;14(11):879–893. PMID 42628555
  9. Zhu D, et al. Mazdutide versus placebo in Chinese adults with type 2 diabetes. Nature. 2026;652(8108):174–180. PMID 41407859
  10. Guo L, et al. Mazdutide versus dulaglutide in Chinese adults with type 2 diabetes. Nature. 2026;652(8108):181–188. PMID 41407860
  11. Innovent Biologics. DREAMS-3 head-to-head study of mazdutide versus semaglutide meets primary endpoint. 26 October 2025. prnewswire.com
  12. Innovent Biologics. 2026 interim results announcement. 25 August 2026. hkexnews.hk
  13. US Food and Drug Administration. Warning letter to a peptide vendor (NuScience Peptides LLC), 24 August 2026. fda.gov
  14. World Anti-Doping Agency. The 2026 Prohibited List (in force 1 January 2026). wada-ama.org

Peptidarium Library. Mazdutide (entry 0028), revision 1.0, 2 November 2026. peptidarium.com/library/mazdutide

08

Revision history

RevDateChangeBy
1.02 Nov 2026Entry created.[Scientific editor]

Spotted an error or a missing paper? Send a correction. Every change is logged here.